« Back
Home /
Recombinant Mouse C-X-C motif chemokine 9(Cxcl9)

Recombinant Mouse C-X-C motif chemokine 9(Cxcl9)

Item no.	CSB-RP092694m-100
Manufacturer	Cusabio
Amount	100 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPN CNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKK ISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
Citations	A macrophage mRNA selectively induced by gamma-interferon encodes a member of the platelet factor 4 family of cytokines.Farber J.M.Proc. Natl. Acad. Sci. U.S.A. 87:5238-5242(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Gamma-interferon-induced monokine;Monokine induced by interferon-gamma ;MIG ;MuMIGProtein m119Small-inducible cytokine B9
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	MW of Fusion: 16, 2
Relevance	May be a cytokine that affects the growth, movent, or activation state of cells that participate in immune and inflammatory response.
Expression Region	22-126aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names	Cxcl9
Sequence Info	Full Length
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer