« Back
Home /
Peptide F, bovine

Peptide F, bovine

Item no.	RP10432
Manufacturer	GenScript
Amount	1 mg
Category	Peptides & Proteins Cell Biology Cell Status Oxidative Stress Peptides
Type	Peptides
Specific against	Cattle (Bovine)
Purity	> 95%
Sequence	YGGFMKKMDELYPLEVEEEANGGEVLGKRYGGFM ; {TYR}{GLY}{GLY}{PHE}{MET}{LYS}{LYS}{MET}{ASP}{GLU}{LEU}{TYR}{PRO}{LEU}{GLU}{VAL}{GLU}{GLU}{GLU}{ALA}{ASN}{GLY}{GLY}{GLU}{VAL}{LEU}{GLY}{LYS}{ARG}{TYR}{GLY}{GLY}{PHE}{MET}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10432-Peptide_F, Proenkephalin peptide F is an enkephalin-containing peptide found predominantly within the adrenal medulla and is co-packaged with epinephrine within adrenal medullary chromaffin granules. Both epinephrine and peptide F can be secreted in response to similar stimuli. Because of this co-secretion, they may possess similar biological functions (e.g. modulating immune function). The response of epinephrine and peptide F are regulated by acute exercise making it a very powerful stimulus to study the acute effects of exercise on the circulatory response patterns of peptide F concentrations in the blood. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Storage at -20C. Keep tightly closed. </td></tr>
Similar products	Peptide
Available
Country of Origin	USA
Storage Conditions	Storage at -20C. Keep tightly closed.
Description	Proenkephalin peptide F is an enkephalin-containing peptide found predominantly within the adrenal medulla and is co-packaged with epinephrine within adrenal medullary chromaffin granules. Both epinephrine and peptide F can be secreted in response to similar stimuli. Because of this co-secretion, they may possess similar biological functions (e.g. modulating immune function). The response of epinephrine and peptide F are regulated by acute exercise making it a very powerful stimulus to study the acute effects of exercise on the circulatory response patterns of peptide F concentrations in the blood.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 11/13/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer