« Back
Home /
Calcitonin, chicken

Calcitonin, chicken

Item no.	RP11096-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Cell Biology Cell Status Necrosis Peptides By Organ Thyroid Cancer
Type	Peptides
Specific against	Chicken (Gallus gallus domesticus)
Purity	> 95%
Sequence	CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 ; {CYS}{ALA}{SER}{LEU}{SER}{THR}{CYS}{VAL}{LEU}{GLY}{LYS}{LEU}{SER}{GLN}{GLU}{LEU}{HIS}{LYS}{LEU}{GLN}{THR}{TYR}{PRO}{ARG}{THR}{ASP}{VAL}{GLY}{ALA}{GLY}{THR}{PRO}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP11096-Calcitonin_chicken, Calcitonin is a hormone known to participate in calcium and phosphorus metabolism. Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. Alternative splicing of the calcitonin pre-mRNA can yield a mRNA encoding calcitonin gene-related peptide, that peptide appears to function in the nervous and vascular systems. The calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein-coupled receptor family.</td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr><tr><th>Notes</th><td colspan="7"> Calcitonin (chicken), which is a single chain peptide with 32 amino acids, stimulates bone formation by inhibiting osteoblasts. Calcitonin induces bone resorption and increases cAMP levels in osteoclasts.</td></tr>
Similar products	Calcitonin
Available
Country of Origin	USA
Storage Conditions	Store at -20C.
Description	Calcitonin is a hormone known to participate in calcium and phosphorus metabolism. Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. Alternative splicing of the calcitonin pre-mRNA can yield a mRNA encoding calcitonin gene-related peptide, that peptide appears to function in the nervous and vascular systems. The calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein-coupled receptor family.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
C-Terminal	NH2
Chemical Bridge	Disulfide bridge: Cys1-7
Notes	Calcitonin (chicken), which is a single chain peptide with 32 amino acids, stimulates bone formation by inhibiting osteoblasts. Calcitonin induces bone resorption and increases cAMP levels in osteoclasts.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 11/13/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer