« Back
Home /
Urocortin III, human

Urocortin III, human

Item no.	RP10100-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Metabolism Glucose Homeostasis Peptides & Proteins Obesity Peptides
Type	Peptides
Specific against	Human (Homo sapiens)
Purity	> 95%
Sequence	FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2 ; {PHE}{THR}{LEU}{SER}{LEU}{ASP}{VAL}{PRO}{THR}{ASN}{ILE}{MET}{ASN}{LEU}{LEU}{PHE}{ASN}{ILE}{ALA}{LYS}{ALA}{LYS}{ASN}{LEU}{ARG}{ALA}{GLN}{ALA}{ALA}{ALA}{ASN}{ALA}{HIS}{LEU}{MET}{ALA}{GLN}{ILE}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10100-Urocortin_III_UcnIII_human, Urocortin III (human) is a highly selective ligand for the CRF-II receptor. The amino acid sequence of the urocortin III peptide corresponds to amino acids 3-40 of stresscopin (human). </td></tr><tr><th>Solubility</th><td colspan="7"> Insoluble in water. Dissolve peptide with 100-200 ul of DMSO then dilute up with desired buffer. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep tightly closed. </td></tr>
Similar products	Urocortin
Available
Country of Origin	USA
Storage Conditions	Store at -20C. Keep tightly closed.
Description	Urocortin III (human) is a highly selective ligand for the CRF-II receptor. The amino acid sequence of the urocortin III peptide corresponds to amino acids 3-40 of stresscopin (human).
Solubility	Insoluble in water. Dissolve peptide with 100-200 ul of DMSO then dilute up with desired buffer.
C-Terminal	NH2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 9/11/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer