« Back
Home /
Pancreastatin, porcine

Pancreastatin, porcine

Item no.	RP10403-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Oncology Neuroscience Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Regulation of Appetite Molecular Targets for Neuroscience Aging & Neurological Disorders By Cell Type Carcinoma Peptides & Proteins Endocrine Regulation of Lipid Metabolism Peptides
Type	Peptides
Specific against	other
Purity	> 95%
Sequence	GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2 ; {GLY}{TRP}{PRO}{GLN}{ALA}{PRO}{ALA}{MET}{ASP}{GLY}{ALA}{GLY}{LYS}{THR}{GLY}{ALA}{GLU}{GLU}{ALA}{GLN}{PRO}{PRO}{GLU}{GLY}{LYS}{GLY}{ALA}{ARG}{GLU}{HIS}{SER}{ARG}{GLN}{GLU}{GLU}{GLU}{GLU}{GLU}{THR}{ALA
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10403-Pancreastatin_PST, Pancreastatin (PST) is one of the chromogranin A (CGA)-derived peptides with known biological activity. Pancreastatin has a general inhibitory effect on secretion in many exocrine and endocrine systems including the heart atrium. Besides, a role of PST as a counter-regulatory peptide of insulin action has been proposed in the light of its effects on glucose and lipid metabolism in the liver and adipose tissue, where receptors and signaling have been described. Galpha(q/11) pathway seems to mediate PST action. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Before using, store the peptide in the DRY form at 0 - 5C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. </td></tr>
Similar products	Pancreastatin
Available
Country of Origin	USA
Storage Conditions	Before using, store the peptide in the DRY form at 0 - 5C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
Description	Pancreastatin (PST) is one of the chromogranin A (CGA)-derived peptides with known biological activity. Pancreastatin has a general inhibitory effect on secretion in many exocrine and endocrine systems including the heart atrium. Besides, a role of PST as a counter-regulatory peptide of insulin action has been proposed in the light of its effects on glucose and lipid metabolism in the liver and adipose tissue, where receptors and signaling have been described. Galpha(q/11) pathway seems to mediate PST action.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
C-Terminal	NH2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 9/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer