« Back
Home /
Helospectin II

Helospectin II

Item no.	RP10593
Manufacturer	GenScript
Amount	1 mg
Category	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Peptides
Type	Peptides
Specific against	other
Purity	> 95%
Sequence	HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPS ; {HIS}{SER}{ASP}{ALA}{THR}{PHE}{THR}{ALA}{GLU}{TYR}{SER}{LYS}{LEU}{LEU}{ALA}{LYS}{LEU}{ALA}{LEU}{GLN}{LYS}{TYR}{LEU}{GLU}{SER}{ILE}{LEU}{GLY}{SER}{SER}{THR}{SER}{PRO}{ARG}{PRO}{PRO}{SER}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10593-Helospectin_II_VIP-PHI-like_peptide, Helospectin I and helospectin II, peptides recently isolated from the salivary gland venom of Heloderma suspectum, were compared to vasoactive intestinal peptide (VIP) with respect to effects on systemic blood pressure and on isolated femoral arteries in the rat. Helospectin I and II relaxed phenylephrine-contracted vessels to the same extent as VIP but with a lower potency. Helospectin I and II have a similar profile of action and therefore may act on a common receptor. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Before using, store the peptide in the DRY form at 0 - 5C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. </td></tr>
Similar products	Helospectin
Available
Country of Origin	USA
Storage Conditions	Before using, store the peptide in the DRY form at 0 - 5C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
Description	Helospectin I and helospectin II, peptides recently isolated from the salivary gland venom of Heloderma suspectum, were compared to vasoactive intestinal peptide (VIP) with respect to effects on systemic blood pressure and on isolated femoral arteries in the rat. Helospectin I and II relaxed phenylephrine-contracted vessels to the same extent as VIP but with a lower potency. Helospectin I and II have a similar profile of action and therefore may act on a common receptor.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 1/8/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer