« Back
Home /
VIP, human, ovine, porcine, rat

VIP, human, ovine, porcine, rat

Item no.	RP10085-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Oncology Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Peptides & Proteins Peptides By Organ Skin Cancer
Type	Peptides
Specific against	Rat (Rattus norvegicus)
Purity	> 95%
Sequence	HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 ; {HIS}{SER}{ASP}{ALA}{VAL}{PHE}{THR}{ASP}{ASN}{TYR}{THR}{ARG}{LEU}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ASN}{SER}{ILE}{LEU}{ASN}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10085-VIP_human_ovine_porcine_rat, Peptide VIP is a Neuropeptide that is widely distributed in the central and peripheral nervous systems, Peptide VIP is a vasodilator, bronchodilator and smooth muscle relaxant. Peptide VIP modulates the activity of many immune system cell types. VIP is a mitogen for embryonic sympathetic neurons and its neuroprotective actions are mediated by the release of activity-dependent neurotrophic factors from glial cells. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water (1 mg/ml), colorless </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep tightly closed. </td></tr>
Similar products	VIP
Available
Country of Origin	USA
Storage Conditions	Store at -20C. Keep tightly closed.
Description	Peptide VIP is a Neuropeptide that is widely distributed in the central and peripheral nervous systems, Peptide VIP is a vasodilator, bronchodilator and smooth muscle relaxant. Peptide VIP modulates the activity of many immune system cell types. VIP is a mitogen for embryonic sympathetic neurons and its neuroprotective actions are mediated by the release of activity-dependent neurotrophic factors from glial cells.
Solubility	Soluble in water (1 mg/ml), colorless
C-Terminal	NH2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP10085-0.5-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 1/8/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer