Comparison

beta-Endorphin, rat European Partner

Item no. RP11346
Manufacturer GenScript
Amount 1 mg
Category
Type Peptides
Specific against Rat (Rattus norvegicus)
Purity > 95%
Sequence YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ ; {TYR}{GLY}{GLY}{PHE}{MET}{THR}{SER}{GLU}{LYS}{SER}{GLN}{THR}{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}{ALA}{ILE}{ILE}{LYS}{ASN}{VAL}{HIS}{LYS}{LYS}{GLY}{GLN}
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP11346-b-Endorphin_beta-Endorphin_rat, Potent endogenous opioid protein that is derived from propiomelanocortin, a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. It is released in response to painful stimuli and has potent antinociceptive activity that is mediated through its action on u receptors in brain and by u and kappa receptors in the spinal cord. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr>
Similar products beta-Endorphin
Available
Country of Origin
USA
Storage Conditions
Store at -20C.
Description
Potent endogenous opioid protein that is derived from propiomelanocortin, a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. It is released in response to painful stimuli and has potent antinociceptive activity that is mediated through its action on u receptors in brain and by u and kappa receptors in the spinal cord.
Solubility
Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close