Comparison

LMX1A (LIM homeobox transcription factor 1. alpha)

Item no. 18-003-42134
Manufacturer GENWAY
Amount 0.05 mg
Category
Type Antibody
Applications WB, IHC
Specific against other
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias GWB-531E97
Similar products 18-003-42134
Available
Genway ID:
GWB-531E97
Antigen Specificity:
Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human LMX1A.
ELISA Titre:
1:12500 Peptide
Sequence:
QNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTAL
Category:
Helix-Turn-Helix
Note:
Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. LMX1A is necessary for the expression of bone morphogenetic protein (BMP). and for the normal generation and differentiation of the dorsal-most spinal cord neurons. the dl1 interneurons.
Function:
Acts as a transcriptional activator by binding to an A/T-rich sequence the FLAT element in the insulin gene promoter. Required for development of the roof plate and in turn for specification of dorsal cell fates in the CNS and developing vertebrae (By similarity).
Subcellular Location:
Nucleus (By similarity).
Tissue Specificity:
Isoform 1 is expressed in many tissues. Not found in heart liver spleen and testis. Relatively highly expressed in fetal brain. Isoform LMX1A-4B is expressed in testis.
Similarity:
Contains 1 homeobox DNA-binding domain.
Similarity:
Contains 2 LIM zinc-binding domains. Summary: Insulin is produced exclusively by the beta cells in the islets of Langerhans in the pancreas. The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear genes that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. LMX1 is a homeodomain protein that binds an A/T-rich sequence in the insulin promoter and stimulates transcription of insulin (German et al. 1994 [PubMed 7698771]). [supplied by OMIM]. Millen. K. J. . et al. . (2004) Dev. Biol. 270 (2). 382-392.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.05 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close