Comparison

TAF1 (TAF1 RNA polymerase II. TATA box binding protein (TBP)-associated factor. 250kDa)

Item no. 18-003-42223
Manufacturer GENWAY
Amount 0.05 mg
Category
Type Antibody
Applications WB, IHC
Specific against other
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias GWB-75884C
Similar products 18-003-42223
Available
Genway ID:
GWB-75884C
Antigen Specificity:
Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human TAF1.
ELISA Titre:
1:62500
Category:
Transcription Factor Antibodies Peptide: YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE
Note:
Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID. which binds to the core promoter to position the polymerase prope Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID which binds to the core promoter to position the polymerase properly serves as the scaffold for assembly of the remainder of the transcription complex and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription serve as coactivators function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF1 encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme. Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID which binds to the core promoter to position the polymerase properly serves as the scaffold for assembly of the remainder of the transcription complex and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription serve as coactivators function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme. Two transcripts encoding different isoforms have been identified for this gene.
Function:
Largest component and core scaffold of the TFIID basal transcription factor complex. Contains novel N- and C-terminal Ser/Thr kinase domains which can autophosphorylate or transphosphorylate other transcription factors. Phosphorylates TP53 on \' Thr-55\' which leads to MDM2-mediated degradation of TP53. Phosphorylates GTF2A1 and GTF2F1 on Ser residues. Possesses DNA-binding activity. Essential for progression of the G1 phase of the cell cycle.
Catalytic Activity:
ATP + a protein = ADP + a phosphoprotein. Cofactor: Magnesium.
Enzyme Regulation:
Autophosphorylates on Ser residues. Inhibited by retinoblastoma tumor suppressor protein RB1.
Subunit:
TAF1 is the largest component of transcription factor TFIID that is composed of TBP and a variety of TBP-associated factors. TAF1 when part of the TFIID complex interacts with C-terminus of TP53. RB1 interacts with the N-terminal domain of TAF1. Interacts with ASF1A and ASF1B.
Subcellular Location:
Nucleus.
Ptm:
Phosphorylated by casein kinase II in vitro.
Disease:
Defects in TAF1 are the cause of X-linked torsion dystonia type 3 (DYT3) [MIM:314250]; also called X-linked dystonia-parkinsonism (XDP). DYT3 is a movement disorder characterized by severe progressive torsion dystonia followed by parkinsonism. The disorder is caused by an SVA (short interspersed nuclear element variable number of tandem repeats and Alu composite) retrotransposon insertion in intron 32 of the TAF1 gene.
Similarity:
Belongs to the TAF1 family.
Similarity:
Contains 2 bromo domains.
Similarity:
Contains 1 HMG box DNA-binding domain.
Similarity:
Contains 2 protein kinase domains. Summary: Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID which binds to the core promoter to position the polymerase properly serves as the scaffold for assembly of the remainder of the transcription complex and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription serve as coactivators function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This protein is the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme. Two transcripts encoding different isoforms have been identified for this gene. Lively. T. N. . et al. . (2004) J. Biol. Chem. 279 (25). 26257-26265.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.05 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close