« Back
Home /
SMPDL3B (sphingomyelin phosphodiesterase. acid-like 3B)

SMPDL3B (sphingomyelin phosphodiesterase. acid-like 3B)

Item no.	18-003-42450
Manufacturer	GENWAY
Amount	0.05 mg
Category	Metabolism Cholesterol & Lipid Metabolism Antibodies Immunohistochemistry Western Blot Cardiovascular Research Thrombosis & Hemostasis Enzymes Fatty Acid Catabolism Primary Antibodies
Type	Antibody
Applications	WB, IHC
Specific against	other
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	GWB-2281D4
Similar products	18-003-42450
Available
Genway ID:	GWB-2281D4
Antigen Specificity:	Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human SMPDL3B.
Immunogen:	ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF
Appearance:	Lyophilized powder
ELISA Titre:	1:312500WB: Antibody
Dilution:	1. 0ug/mlIHC: 4-8ug/ml
Handling:	Add 50ul of distilled water to this antibody before use.
Note:	Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. Located on chromosome 1. this gene encodes for acid sphingomyelinase-like phosphodiesterase 3b precursor protein. N/AN/A Strausberg. R. L. . et al. . (2002) Proc. Natl. Acad. Sci. U. S. A. 99 (26). 16899-16903.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.05 mg

available

Delivery expected until 10/30/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer