« Back
Home /
MAFB (v-maf musculoaponeurotic fibrosarcoma oncogene homolog B (avian))

MAFB (v-maf musculoaponeurotic fibrosarcoma oncogene homolog B (avian))

Item no.	18-003-43433
Manufacturer	GENWAY
Amount	0.1 mg
Category	Oncology Neuroscience Targets for Rodent Neurosciences Antibodies By Cell Type Hematology Leukemia Myeloma Sarcoma Immunohistochemistry Western Blot Primary Antibodies
Type	Antibody
Applications	WB, IHC
Specific against	other
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	GWB-B5436C
Similar products	18-003-43433
Available
Genway ID:	GWB-B5436C
Antigen Specificity:	Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human MAFB. Peptide
Sequence:	MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQ
Appearance:	Lyophilized powder
Western Blotting:	Antibody
Dilution:	1. 25& #956; g/ml Immunohistochemistry: 4-8 & #956; g/ml
Handling:	Add 100& #956; l of distilled water to this antibody before use
ELISA Titre:	1:312500
Note:	Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. MAFB is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. The protein
Function:	Plays a pivotal role in regulating lineage-specific hematopoiesis by repressing ETS1-mediated transcription of erythroid-specific genes in myeloid cells (By similarity).
Subunit:	Interacts with the intracellular cytoplasmic domain of LRP1 (LRPICD). This interaction results in a moderate reduction of MAFB transcriptional potential.
Subcellular Location:	Nucleus (By similarity).
Domain:	The leucine-zipper domain is involved in the interaction with LRPICD.
Similarity:	Belongs to the bZIP family. Maf subfamily.
Similarity:	Contains 1 bZIP domain. Summary: The protein encoded by this gene is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The encoded nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. This protein contains no introns. Bakri. Y. . (2005) Blood 105 (7). 2707-2716.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.1 mg

available

Delivery expected until 10/30/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer