« Back
Home /
TIMELESS (timeless homolog (Drosophila))

TIMELESS (timeless homolog (Drosophila))

Item no.	18-003-43438
Manufacturer	GENWAY
Amount	0.05 mg
Category	Oncology Antibodies Immunohistochemistry Western Blot Primary Antibodies By Organ Lung Cancer
Type	Antibody
Applications	WB, IHC
Specific against	other
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	GWB-4D95B2
Similar products	18-003-43438
Available
Genway ID:	GWB-4D95B2
Antigen Specificity:	Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human TIMELESS.
Immunogen:	Synthetic peptide sequence derived from:IGERDLIFHKGLHNLRNYSSDLGKQPKKVPKRRQAARELSIQRRSALNVR
Appearance:	Lyophilized powder
Western Blotting:	Antibody dillution: 0. 25ug/ml Immunohistochemistry: 4-8ug/mlHanding: Add 50ul of distilled water to this antibody before use
ELISA Titre:	1:312500
Note:	Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. The human Timeless protein interacts with both the circadian clock protein cryptochrome 2 and with the cell cycle checkpoint proteins Chk1 and the ATR-ATRIP complex and plays an important role in the DNA damage checkpoint response. Down-regulation of Time
Function:	Required for normal progression of S-phase. Involved in the circadian rhythm autoregulatory loop. Negatively regulates CLOCK-NPAS2/BMAL1-induced transactivation of PER1 possibly via translocation of PER1 into the nucleus. Promotes TIPIN nuclear localiZation. Involved in cell survival after DNA damage or replication stress. May be specifically required for the ATR-CHK1 pathway in the replication checkpoint induced by hydroxyurea or ultraviolet light. May also play an important role in epithelial cell morphogenesis and formation of branching tubules.
Subunit:	Homomultimer. Component of the circadian core oscillator which includes the CRY proteins CLOCK or NPAS2 BMAL1 or BMAL2 CSKN1D and/or CSNK1E TIMELESS and the PER proteins. Interacts directly with PER1 PER2 and PER3. Interacts with PER2 via its second PAS domain in vitro. Binds CRY1 CRY2 CHK1 ATR and ATRIP (By similarity). Interacts with TIPIN and CLSPN.
Subcellular Location:	Nucleus.
Tissue Specificity:	Expressed in all tissues examined including brain heart lung liver skeletal muscle kidney placenta pancreas spleen thymus and testis. Highest levels of expression in placenta pancreas thymus and testis.
Induction:	Regulated by the cell cycle. High levels in S G(2) and M phases with highest level in S phase. Low expression in G(0) and G(1) phases.
Similarity:	Belongs to the timeless family. Maruyama. K. (2005) Mol. Cell. Biol. 25 (8). 3109-3116.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.05 mg

available

Delivery expected until 9/25/2025

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer