PPARGC1B

GWB-35B4F3

2. 5ug/ml

1:62500

KRNEPSFHLSYGGLRHFRWPRYTDYDPTSEESLPSSGKSKYEAMDFDSLL

Plays a role of stimulator of transcription factors and nuclear receptors activities. Activates transcritional activity of estrogen receptor alpha nuclear respiratory factor 1 (NRF1) and glucocorticoid receptor in the presence of glucocorticoids. May play a role in constitutive non-adrenergic-mediated mitochondrial biogenesis as suggested by increased basal oxygen consumption and mitochondrial number when overexpressed. May be part of the pathways regulating the elevation of gluconeogenesis beta-oxidation of fatty acids and ketogenesis during fasting. Stimulates SREBP-mediated lipogenic gene expression in the liver. Induces energy expenditure and antagonizes obesity when overexpressed. Induces also the expression of mitochondrial genes involved in oxidative metabolism.

Nucleus (By similarity).

Induced by fasting in the liver but not by cold exposure in brown adipose tissue. Induced also by saturated fatty acids in primary hepatocytes.

Transgenic mice overexpressing PPARGC1B exhibits increased expression of medium-chain acyl CoA dehydrogenase. They are hyperphagic but lean with increased energy expenditure and resistance to obesity.