« Back
Home /
LL37 Human

LL37 Human

Item no.	06-271-83309
Manufacturer	GENWAY
Amount	0.2 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GWB-FF93A1
Similar products	06-271-83309
Available
Genway ID:	GWB-FF93A1
Sequence (One Letter Code):	LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Sequence:	{LEU} {LEU} {GLY} {ASP} {PHE} {PHE} {ARG} {LYS} {SER} {LYS} {GLU} {LYS} {ILE} {GLY} {LYS} {GLU} {PHE} {LYS} {ARG} {ILE} {VAL} {GLN} {ARG} {ILE} {LYS} {ASP} {PHE} {LEU} {ARG} {ASN} {LEU} {VAL} {PRO} {ARG} {THR} {GLU} {SER}
Solubility:	InSoluble in water. Dissolve peptide in 10% Acetonitrile with 0. 1% TFA solution. Further dilute with desired buffer. The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium. LL-37(human) is a cathelicidin-derived peptide with antimicrobial and angiogenic activity.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.2 mg

available

Delivery expected until 10/9/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer