« Back
Home /
SNRP70 (small nuclear ribonucleoprotein 70kDa polypeptide (RNP antigen))

SNRP70 (small nuclear ribonucleoprotein 70kDa polypeptide (RNP antigen))

Item no.	18-003-43559
Manufacturer	GENWAY
Amount	0.1 mg
Category	Infectious Diseases Viral Infections Coronavirus (COVID-19) Peptides & Proteins Immunohistochemistry Western Blot Peptides
Type	Peptides
Applications	WB, IHC
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GWB-8FC035
Similar products	18-003-43559
Available
Genway ID:	GWB-8FC035
Antigen Specificity:	Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human SNRP70. Peptide
Sequence:	YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK
ELISA Titre:	1:62500MW: 48kDa
Note:	Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. Western Blot: Suggested dilution at 5. 0 microg/mlIHC: 4-8ug/ml
Handling:	Add 10ul of distilled water to this antibody before use. SNRP70 contains 1 RRM (RNA recognition motif) domain and mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests
Function:	Mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA. The truncated isoforms cannot bind U1-snRNA.
Subunit:	Found in a pre-mRNA splicing complex with SFRS4 SFRS5 SNRP70 SNRPA1 SRRM1 and SRRM2. Found in a pre-mRNA exonic splicing enhancer (ESE) complex with SFRS10 SNRP70 SNRPA1 and SRRM1. Interacts with dephosphorylated FUSIP1 and SFPQ. Interacts with NUDT21/CPSF5 CPSF6 SFRS2IP and ZRANB2.
Subcellular Location:	Nucleus.
Ptm:	The N-terminus is blocked.
Ptm:	Extensively phosphorylated on serine residues in the C-terminal region.
Disease:	Major ribonucleoprotein antigen recognized by the sera from patients with autoimmune diseases such as systemic lupus erythematosus.
Similarity:	Contains 1 RRM (RNA recognition motif) domain. Brandenberger. R. . (2004) Nat. Biotechnol. 22 (6). 707-716.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.1 mg

available

Delivery expected until 9/11/2025

Express Delivery: Save 7 days

Compare

Add to wishlist

Get an offer