« Back
Home /
Insulin peglispro

Insulin peglispro

Item no.	HY-P4062-1ea
Manufacturer	MedChem Express
CASRN	1200440-65-8
Amount	1 ea
Category	Inhibitors & Compound Libraries Small Molecules
Type	Inhibitor
Specific against	other
Formula	C370H566N104O110S4
Citations	[1]Richard A Byrd, et al. Chronic Toxicology Studies of Basal Insulin Peglispro in Rats and Dogs: A Novel, PEGylated Insulin Lispro Analog with a Prolonged Duration of Action. Toxicol Pathol. 2017 Apr;45(3):402-415.
Smiles	[Chain1:FVNQHLCGSHLVEALYLVCGERGFFYTKPT<br />Chain2:GIVEQCCTSICSLYQLENYCN<br />(Disulfide chain 1 cys7-chain 2 cys7, Disulfide chain 1 cys19-chain 2 cys20, Disulfide chain 2 cys6-cys11)]
ECLASS 10.1	32160490
ECLASS 11.0	32160490
UNSPSC	12000000
Alias	BIL
Shipping condition	Room temperature
Available
Manufacturer - Type	Peptides
Manufacturer - Applications	Metabolism-sugar/lipid metabolism
Manufacturer - Targets	Insulin Receptor
Shipping Temperature	Room Temperature
Product Description	Insulin peglispro (BIL) is a basal insulin with a flat, prolonged activity profile. Insulin peglispro can exhibit better glycaemic control compared to conventional insulins[1].
Manufacturer - Research Area	Metabolic Disease
Solubility	10 mM in DMSO
Manufacturer - Pathway	Protein Tyrosine Kinase/RTK
Clinical information	No Development Reported

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 ea

available

Request delivery time