Comparison

Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide European Partner

Item no. HY-P3616-1ea
Manufacturer MedChem Express
Amount 1 ea
Category
Type Separation, Purification
Specific against other
Formula C19H18N4O4
Citations [1]Kreymann B, et al. Glucagon-like peptide-1 7-36: a physiological incretin in man. Lancet. 1987 Dec 5;2(8571):1300-4.
[2]Gutniak M, et al. Antidiabetogenic effect of glucagon-like peptide-1 (7-36)amide in normal subjects and patients with diabetes mellitus. N Engl J Med. 1992 May 14;326(20):1316-22.
Smiles [HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-{Biotin-Lys}-NH2]
ECLASS 10.1 32170301
ECLASS 11.0 32170301
UNSPSC 41104900
Shipping Condition Room temperature
Available
Manufacturer - Type
Peptides
Manufacturer - Applications
Metabolism-protein/nucleotide metabolism
Manufacturer - Targets
GCGR
Shipping Temperature
Room temperature
Molecular Weight
3652.10
Product Description
Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide is a biotin labeled glucagon-like peptide-1-(7-36). Glucagon-like peptide-1-(7-36) is a gastrointestinal peptide with antidiabetogenic activity, and can increase the release of insulin[1][2].
Manufacturer - Research Area
Metabolic Disease
Solubility
10 mM in DMSO
Manufacturer - Pathway
GPCR/G Protein
Clinical information
No Development Reported

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 ea
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close