« Back
Home /
Agouti-Related Protein (Human, 86-132)

Agouti-Related Protein (Human, 86-132)

Item no.	BNTH-PAR-4366-S-0,1mg
Manufacturer	BIOSYNTH
Amount	0.1 mg
Category	Metabolism Glucose Homeostasis Regulation of Appetite Obesity Reagents & Chemicals Molecules
Type	Molecules
Specific against	other
Citations	R.D. Rosenfeld, L. Zeni, A.A. Welcher, L.O. Narhi, C. Hale, J. Marasco, J. Delaney, T. Gleason, J.S. Philo, V. Katta, J. Hui, H. Baumgartner, M. Graham, K.L. Stark, and W. Karbon, Biochemistry, 37, 16041 (1998). (Original) E.J. Bures, J.O. Hui, Y. Young, D.T. Chow, V. Katta, M.F. Rohde, L. Zeni, R.D. Rosenfeld, K.L. Stark, and M. Haniu, Biochemistry, 37, 12172 (1998). (Structure; S-S Bond) J.R. Shutter, M. Graham, A.C. Kinsey, S. Scully, R. Lüthy, and K.L. Stark, Genes Dev., 11, 593 (1997). (Agouti-Related Transcript Sequence) D.M. Diinulescu and R.D. Con, J. Bio.. Chem., 275, 6695 (2000). (Review). T.R.H. Buch et al., JBC, 284 (39), 26411 (2009).
ECLASS 10.1	32169090
ECLASS 11.0	32169090
UNSPSC	12000000
Alias	Arg-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr- Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr AGRP (Human, 86-132)
Available
Manufacturer - Category	Life Sciences / Peptides and Biochemicals / Research Peptides
Shipping Temperature	No Dry Ice
Storage Conditions	-20 C
Molecular Weight	5, 347.2 g/mol
Model	Agouti-Related Protein (Human, 86-132) (0.1mg vial)
Description	Potent inhibitor of melanocortin receptor function
Application info	Melanocortin Receptor-3/4 Antagonist; Appetite Boosting Peptide
Disulfide bonds	(Disulfide bonds between Cys87-Cys102, Cys94-Cys108, Cys101-Cys119, Cys105-Cys129, and Cys110-Cys117)
One letter code	RCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.1 mg

available

Delivery expected until 10/16/2025

Express Delivery: Save 30 days

Compare

Add to wishlist

Get an offer