Comparison

Glucagon-like Peptide 2 (Human) European Partner

Item no. BNTH-PGL-4376-V-0,5mg
Manufacturer BIOSYNTH
CASRN 223460-79-5
Amount 0.5 mg
Category
Type Molecules
Specific against other
Citations D.J. Drucker, Gut, 50, 4289 (2002). (Review) B. Hartmann, A.H. Johnsen, C. Ørskov, K. Adelhorst, L. Thim, and J.J. Holst, Peptides, 21, 73 (2000). (Pharmacol.)
M. Tang-Christensen, P.J. Larsen, J. Thulesen, J. Rømer, and N. Vrang, Nat. Med., 6, 802 (2000). (Pharmacol.)
E. Blázquez, E. Alvarez, M. Navarro, I. Roncero, F. Rodríguez-Fonseca, J.A. Chowen, and J.A. Zueco, Mol. Neurobiol., 18, 157 (1998). (Review)
G. van Dijk and T.E. Thiele, Neuropeptides, 33, 406 (1999). (Review)
D.J. Drucker, Gut, 50, 428 (2002). (Review)
Smiles CCC(C)C(C(=O)NC(C(C)O)C(=O)NC(CC(=O)O)C(=O)O)NC(=O)C(CCCCN)NC(=O)C(C(C)O)NC(=O)C(CCC(=O)N)NC(=O)C(C(C)CC)NC(=O)C(CC(C)C)NC(=O)C(CC1=CNC2=CC=CC=C21)NC(=O)C(CC(=O)N)NC(=O)C(C(C)CC)NC(=O)C(CC3=CC=CC=C3)NC(=O)C(CC(=O)O)NC(=O)C(CCCNC(=N)N)NC(=O)C(C)NC(=O)C(C)NC(=O)C(CC(C)C)NC(=O)C(CC(=O)N)NC(=O)C(CC(=O)O)NC(=O)C(CC(C)C)NC(=O)C(C(C)CC)NC(=O)C(C(C)O)NC(=O)C(CC(=O)N)NC(=O)C(CCSC)NC(=O)C(CCC(=O)O)NC(=O)C(CC(=O)O)NC(=O)C(CO)NC(=O)C(CC4=CC=CC=C4)NC(=O)C(CO)NC(=O)CNC(=O)C(CC(=O)O)NC(=O)C(C)NC(=O)C(CC5=CNC=N5)N
ECLASS 10.1 32169090
ECLASS 11.0 32169090
UNSPSC 12000000
Alias H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-H-Thr-Lys-Ile-Thr- Asp-OH,GLP-2 (human)
Hazard information Not controlled, not hazardous for shipping
Available
Manufacturer - Category
Life Sciences / Peptides and Biochemicals / Research Peptides
Shipping Temperature
No Dry Ice
Storage Conditions
-20 C
Molecular Weight
3, 766.1 g/mol
Model
Glucagon-like Peptide 2 (Human) (0.5 mg vial)
One letter code
HADGSFSDEMNTILDNLAARDFINWLIQTKITD

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.5 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close