Comparison

Midkine (Human, 60-121) European Partner

Item no. BNTH-PMK-4299-S-0,1mg
Manufacturer BIOSYNTH
Amount 0.1 mg
Category
Type Molecules
Specific against other
Citations H. Muramatsu, T. Inui, T. Kimura, S. Sakakibara, X.-J. Song, H. Maruta, and T. Muramamtsu, Biochem. Biophys. Res. Commun., 203, 1131 (1994)
J.-i. Tsutsui, K. Uehara, K. Kadomatsu, S. Matsubara, and T. Muramatsu, Biochem. Biophys. Res. Commun., 176, 792 (1991). (Original)
T. Inui, J. Bodi, S. Kubo, H. Nishio, T. Kimura, S. Kojima, H. Maruta, T. Muramatsu, and S. Sakakibara, J. Peptide Sci., 2, 28 (1996). (Chem. Synthesis)
G.S.P. Yu, J. Hu, and H. Nakagawa, Neurosci. Lett., 254, 128 (1998). (Pharmacol.; Inhibition of ß-amyloid cytotoxicity)
ECLASS 10.1 32169090
ECLASS 11.0 32169090
UNSPSC 12000000
Alias Ala-Asp-Cys-Lys-Tyr-Lys-Phe-Glu-Asn-Trp-Gly-Ala-Cys-Asp-Gly-Gly-Thr-Gly-Thr-Lys-Val-Arg-Gln-Gly-Thr-Leu-Lys-Lys-Ala-Arg-Tyr-Asn-Ala- Gln-Cys-Gln-Glu-Thr-Ile-Arg-Val-Thr-Lys-Pro-Cys-Thr-Pro-Lys-Thr-Lys-Ala-Lys-Ala-Lys-Ala-Lys-Lys-Gly-Lys-Gly-Lys-Asp
Available
Manufacturer - Category
Life Sciences / Peptides and Biochemicals / Research Peptides
Shipping Temperature
No Dry Ice
Storage Conditions
-20 C
Molecular Weight
6, 788.8 g/mol
Model
Midkine (Human, 60-121) (0.1mg vial)
Application info
Heparin-Binding Growth/Differentiation Factor Active-Domain (Neurite Outgrowth-Promoting Factor) Plasminogen Activator Activity Enhancer
Disulfide bonds
(Disulfide bonds between Cys62-Cys94 and Cys72-Cys104)
One letter code
ADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close