« Back
Home /
Ras-Related C3 Botulinum Toxin substrate 1 Human Recombinant ( RAC1 Human )

Ras-Related C3 Botulinum Toxin substrate 1 Human Recombinant ( RAC1 Human )

Item no.	PT_41922_1mg
Manufacturer	Novateinbio
Amount	1 mg
Category	Peptides & Proteins Recombinant Proteins Cell Biology Cytoskeleton small GTPases Rho Subfamily
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Purity	Greater than 95.0% as determined by SDS-PAGE.
Sequence	MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Ras-Related C3 Botulinum Toxin substrate 1 Human Recombinant ( RAC1 Human )
Similar products	Ras-Related C3 Botulinum Toxin substrate 1 Human Recombinant ( RAC1 Human )
Available
Description	Ras-Related C3 Botulinum Toxin substrate 1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 192 amino acids and having a molecular mass of 21.4 kDa.
Storage/Stability	Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Purity	Greater than 95.0% as determined by SDS-PAGE.
Form	The protein solution contains 20mM Tris-HCl pH7.5, 2mM EDTA and 1mM DTT.
Protein Background	RAC1 is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. RAC-1 regulates the actin cytoskeleton but also other cellular processes. RAC1 have been shown to be involved in the regulation of cell-cell adhesion.
Expression host	Escherichia Coli.
Reagent Appearance	Sterile Filtered colorless solution.
Amino acid sequence	MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL.
Manufacturers Category	Cancer

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 10/9/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer