« Back
Home /
Interleukin-1 beta Rat Recombinant ( IL 1 beta Rat )

Interleukin-1 beta Rat Recombinant ( IL 1 beta Rat )

Item no.	PT_41128_1mg
Manufacturer	Novateinbio
Amount	1 mg
Category	Neuroscience Neuroinflammation Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion Cell Culture Cytokines
Type	Proteins Recombinant
Format	Lyophilized
Specific against	Rat (Rattus norvegicus)
Purity	Greater than 97.0% as determined by SDS-PAGE.
Sequence	MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Interleukin-1 beta Rat Recombinant ( IL 1 beta Rat )
Similar products	Interleukin-1 beta Rat Recombinant ( IL 1 beta Rat )
Available
Description	Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa.The IL-1b is purified by proprietary chromatographic techniques.
Storage/Stability	Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Purity	Greater than 97.0% as determined by SDS-PAGE.
Form	The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4.
Reconstitution	In PBS, pH 7.4 and 0.1 % NaN3.
Protein Background	Interleukin-1b is produced by activated macrophages, IL-1B stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1B proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Expression host	Escherichia Coli.
Reagent Appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Amino acid sequence	MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS.
Biological Activity	The ED50 was found to be less than 0.1ng/ml, determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10, 000, 000 units/mg.
Solubility	It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Manufacturers Category	Immunology

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 11/13/2025

Express Delivery: Save 31 days

Compare

Add to wishlist

Get an offer