« Back
Home /
ADAMTS-13 FRET Substrate, FRETS-VWF73 - 0.1 mg

ADAMTS-13 FRET Substrate, FRETS-VWF73 - 0.1 mg

Item no.	AS-63728-01
Manufacturer	AnaSpec
Amount	0.1 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Asp-Arg-Glu-Dap(Nma)-Ala-Pro-Asn-Leu-Val-Tyr-Met-Val-Thr-Gly-Dap(Dnp)-Pro-Ala-Ser-Asp-Glu-Ile-Lys-Arg-Leu-Pro-Gly-Asp-Ile-Gln-Val-Val-Pro-Ile-Gly-Val-Gly-Pro-Asn-Ala-Asn-Val-Gln-Glu-Leu-Glu-Arg-Ile-Gly-Trp-Pro-Asn-Ala-Pro-Ile-Leu-Ile-Gln-Asp-Phe-Glu-Thr
Citations	K. Kokame, et al. Br. J. Haematol., 129, 93-100 (2005)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DRE-Dap(Nma)-APNLVYMVTG-Dpa-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Applications	FRET; Protease activity
Manufacturer - Category	Peptides
Manufacturer - Targets	ADAMTS-13
Manufacturer - Conjugate / Tag	Dnp
Shipping Temperature	RT
Storage Conditions	- 20 °C Protected from light
Molecular Weight	8314.9
Description	FRETS-VWF73 is a very powerful Fluorescence-Quenching Substrate for the VWF cleaving protease ADAMTS-13. It is commonly used as a useful tool for the rapid measurement of ADAMTS-13 activity in plasma and is a predictive marker for various thrombotic diseases like TPP. Our new substrate FRETS-VWF73 can be easily used with a 96-well format in commercial plate readers.
Product Group	LB1A4Z
Research Area	Cardiovascular Research; Cell Signaling / Lyophilized
Absorbtion (nm)	340
Emission (nm)	440
Sequence One-Letter Code	DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
GTIN	5400535147037
Detection Method	Fluorescent
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-63728-01-safety-datasheet.pdf