« Back
Home /
Big Endothelin-3 (Human, 1-41 Amide)

Big Endothelin-3 (Human, 1-41 Amide)

Item no.	PEP-PED-3739-PI-5mg
Manufacturer	Peptides International
Amount	5mg
Type	Molecules
Specific against	other
ECLASS 10.1	32169090
ECLASS 11.0	32169090
UNSPSC	12000000
Similar products	133551-97-0
Available
Model	Big Endothelin-3 (Human, 1-41 Amide)
Disulfide bonds	Disulfide bonds between Cys1-Cys15 and Cys3-Cys11
One letter code	H-CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH2
Molecular weight	4923, 65
Chemical sequence	C223H322N56O63S4
CAS number	133551-97-0
Storage temp	-20 C
Synonyms	Big ET-3 (human), Big Endothelin-3 (1-41), amide, human, Big ET-3 (1-41) amide (human) H-Cys-Thr-Cys-Phe-Thr-Tyr-Lys-Asp-Lys-Glu-Cys-Val-Tyr-Tyr-Cys-His-Leu-Asp-Ile-Ile-Trp-Ile-Asn-Thr-Pro-Glu-Gln-Thr-Val-Pro-Tyr-Gly-Leu-Ser-Asn-Tyr-Arg-Gly-Ser-Phe-Arg-NH2
References	T. Kosaka, N. Suzuki, Y. Ishibashi, H. Matsumoto, Y. Itoh, S. Ohkubo, K. Ogi, C. Kitada, H. Onda, and M. Fujino, J. Biochem., 116, 443 (1994). (Original; Biosynthesis) M. Yanagisawa and T. Masaki, Trends Pharmacol. Sci., 10, 374 (1989). (Review) T. Sakurai, M. Yanagisawa, and T. Masaki, Trends Pharmacol. Sci., 13, 103 (1992). (Review) K.D. Bloch, R.L. Eddy, T.B. Shows, and T. Quertermous, J. Biol. Chem., 264, 18156 (1989). (Original; cDNA)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 5mg

available

Delivery expected until 10/9/2025

Express Delivery: Save 16 days

Compare

Add to wishlist

Get an offer