« Back
Home /
Galanin-like Peptide (Human, 1-60) (0.1mg vial)

Galanin-like Peptide (Human, 1-60) (0.1mg vial)

Item no.	PEP-PGL-4391-s-1ea
Manufacturer	Peptides International
Amount	1ea
Type	Molecules
Specific against	other
ECLASS 10.1	32169090
ECLASS 11.0	32169090
UNSPSC	12000000
Available
Model	Galanin-like Peptide (Human, 1-60) (0.1mg vial)
One letter code	APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS
Molecular weight	6500, 3
Chemical sequence	C292H451N83O84S
Storage temp	-20 C
Application info	Ligand for Galanin Receptor 2 / Target Peptide for Feeding Regulation by Leptin
Synonyms	Ala-Pro-Ala-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Leu-Pro-Gln-Met-Gly-Asp-Gln-Asp-Gly-Lys-Arg-Glu-Thr-Ala-Leu-Glu-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Ser-His-Pro-Pro-Gln-Pro-Ser, GALP (Human, 1-60)
References	T. Ohtaki, S. Kumano, Y. Ishibashi, K. Ogi, H. Matsui, M. Harada, C. Kitada, T. Kurokawa, H. Onda, and M. Fujino, J. Biol. Chem., 274, 37041 (1999). (Original) Y. Matsumoto, T. Watanabe, Y. Adachi, T. Itoh, T. Ohtaki, H. Onda, T. Kurokawa, O. Nishimura, and M. Fujino, Neurosci. Lett., 322, 67 (2002). (Stimulation of Food Intake) A. Juré us, M.J. Cunningham, M.E. Mcclain, D.K. Clifton, and R.A. Steiner, Endocrinology, 141, 2703 (2000). (Pharmacol.) A.J. Kastin, V. Akerstrom, and L. Hackler, Neuroendocrinology, 74, 423 (2001). (Brain Entry) A.L. Gundlach, Eur. J. Pharmacol., 440, 255 (2002). (Review)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1ea

available

Delivery expected until 9/11/2025

Express Delivery: Save 15 days

Compare

Add to wishlist

Get an offer