« Back
Home /
Recombinant Human CUGBP Elav-like family member 1 (CELF1) (T173E, S178D, S285D, S288D, S295D, S296D, S298D, L408A, P409A)

Recombinant Human CUGBP Elav-like family member 1 (CELF1) (T173E, S178D, S285D, S288D, S295D, S296D, S298D, L408A, P409A)

Item no.	BM-RPC27343-1mg
Manufacturer	Biomatik
Amount	1 mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
Sequence	MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRMLRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQEMEGCDSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAM
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CELF-1, 50 kDa nuclear polyadenylated RNA-binding protein, Bruno-like protein 2, CUG triplet repeat RNA-binding protein 1, CUG-BP1, CUG-BP- and ETR-3-like factor 1, Deadenylation factor CUG-BP, Embryo deadenylation element-binding protein homolog, EDEN-BP homolog, RNA-binding protein BRUNOL-2
Available
Manufacturer - Conjugate / Tag	Unconjugated, N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	53.6 kDa
Manufacturer - Research Area	Epigenetics and Nuclear Signaling
Protein Type	Recombinant Protein
Expression Region	1-482aa (T173E, S178D, S285D, S288D, S295D, S296D, S298D, L404A, P405A)
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	CELF1
Sequence Information	Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 8/28/2025

Compare

Add to wishlist

Get an offer

Request delivery time