« Back
Home /
Recombinant Human Tumor necrosis factor receptor superfamily member 11B (TNFRSF11B), Active Protein

Recombinant Human Tumor necrosis factor receptor superfamily member 11B (TNFRSF11B), Active Protein

Item no.	BM-RPC28069-1mg
Manufacturer	Biomatik
Amount	1 mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Format	Lyophilized
Specific against	Human (Homo sapiens)
Host	Mammalian cells
Conjugate/Tag	Unconjugated, FLAG
Purity	>90% by SDS-PAGE
Sequence	ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDL
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Shipping Condition	Cool pack
Available
Specificity	Human (Homo sapiens)
Manufacturer - Category	Protein
Manufacturer - Targets	TNFRSF11B
Manufacturer - Conjugate / Tag	Unconjugated, C-Terminal Mfc-Avi-Tagged
Shipping Temperature	Ice packs
Storage Conditions	-20°C. Avoid repeated freeze/thaw cycles.
Molecular Weight (Theoretical)	73.5kDa
Manufacturer - Research Area	Cancer
Protein Length	Full Length of Mature Protein
Protein Type	Active Recombinant Protein
Expression Region	22~401aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures.
Expiration	12 months
Reconstitution	Refer to the datasheet/CoA included in the product pouch.
Endotoxin	<1.0 EU/ug, by LAL method
Quality Systems	This product is manufactured at ISO 9001 certified facilities.
Quality Guarantee	This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details.
Long Description	Recombinant Human Tumor necrosis factor receptor superfamily member 11B (TNFRSF11B), Active Protein is a purified Active Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens). Target Name: TNFRSF11B. Accession Number: O00300. Expression Region: 22~401aa. Tag Info: C-Terminal Hfc-Flag-Tagged. Theoretical MW: 73.5kDa Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Short Description	Recombinant Human Tumor necrosis factor receptor superfamily member 11B (TNFRSF11B), Active Protein is a purified Active Recombinant Protein.
Activity	Biologically Active

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 9/25/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer