L3MBTL3, Recombinant, Human, aa229-547, His-Tag (Lethal(3) Malignant Brain Tumor-Like Protein 3)

Dry Ice

37, 6

Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 19mM imidazole, 0.005% Tween 20, 20% glycerol.

PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Its association with a chromatin-remodeling complex suggests that it may contribute to prevent expression of genes that trigger the cell into mitosis.

Source:
Recombinant protein corresponding to aa229-547 from human L3MBTL3, fused to His-tag at N-terminal, expressed in E. coli.

Molecular Weight:
~37.6kD

AA Sequence:
MHHHHHHKKAWCWASYLEEEKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPE
HQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPK
GYKEEEFNWQTYLKTCKAQAAPKSLFENQNITVIPSGFRVGMKLEAVDKKNPSFICVA
TVTDMVDNRFLVHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYPNVKHF
SWDKYLEETNSLPAPARAFKVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHR
VKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPLSPL

Applications:
Suitable for use in the study of Polycomb group (PcG) proteins, protein binding assays, screening inhibitors, and selectivity profiling. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.