PHIP (BD1), Recombinant, Human, aa1146-1287, His-Tag (Bromodomain Pleckstrin Homology Domain Interacting Protein, IRS-1 PH Domain-Binding Protein, WDR11, BRWD2)

Dry Ice

17

Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.

PHIP is a bromodomain-containing protein that binds the pleckstrin homology (PH) domain of insulin receptor substrate-1 (IRS1), modulates insulin signaling, and plays a role in pancreatic beta cell growth and survival. It stimulates cell proliferation through regulation of cyclin transcription and has an anti-apoptotic activity through AKT1 phosphorylation and activation.

Source:
Recombinant protein corresponding to bromodomain 1, aa1146-1287, from human PHIP, fused to His-tag at N-terminal, expressed in E. coli.

Molecular Weight:
~17kD

AA Sequence:
MHHHHHHSLIYKPLDGEWGTNPRDEECERIVAGINQLMTLDIASAFVAPVDLQAYPMY
CTVVAYPTDLSTIKQRLENRFYRRVSSLMWEVRYIEHNTRTFNEPGSPIVKSAKFVTDL
LLHFIKDQTCYNIIPLYNSMKKKVLSDSEDEE

Applications:
Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.