SMARCA2, Bromodomain, Recombinant, Human, aa1375-1511, His-Tag (BRM, BRG1-Associated Factor 190B, SWI/SNF Related, Matrix Associated, Actin Dependent Regulator Of Chromatin 2, BAF190, SNF2L2)

Dry Ice

16, 9

Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol.

The protein encoded by this gene is a member of the SWI/SNF family of proteins and is highly similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, which contains a trinucleotide repeat (CAG) length polymorphism. [provided by RefSeq, Jan 2014]

Source:
Recombinant protein corresponding to aa1375-1511 from human Bromodomain SMARCA2, fused to His-tag at N-terminal, expressed in E. coli.

Molecular Weight:
~16.9kD

AA Sequence:
MHHHHHHKLSPNPPKLTKQMNAIIDTVINYKDRCNVEKVP
SNSQLEIEGNSSGRQLSEVFIQLPSRKELPEYYELIRKPV
DFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQ
IYEDSIVLQSVFKSARQKIAKEEE

Applications:
Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.