« Back
Home /
PDKtide (Biotin)

PDKtide (Biotin)

Item no.	USB-P3123-76A
Manufacturer	United States Biological
Amount	1 mg
Category	Peptides & Proteins Enzymes
Type	Enzymes
Format	Lyophilized
Specific against	other
Conjugate/Tag	Biotin
ECLASS 10.1	32160410
ECLASS 11.0	32160410
UNSPSC	12352204
Shipping Condition	Cool pack
Available
Manufacturer - Category	Molecular Biology / MB-Protein Kinases
Shipping Temperature	Blue Ice
Storage Conditions	-20°C
Molecular Weight	4997, 66
Grade	Purified
Form	Supplied as a lyophilized powder.
EU Commodity Code	38220090
Description	Amino Acid Sequence: [protein fragment, 39 aa] Labeled with Biotin (linear) Molecular Formula: C222H328N56O68S4 Molecular Weight: 4997.66 Purity: ≥80% Form: Supplied as a lyophilized powder Storage and Stability: Lyophilized powder may be stored at 4°C for short-term only. Stable for 6 months after receipt at -20°C. Reconstitute (see reconstitution instructions for peptides) and store at -20°C. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Shelf Life	1 year

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 3/12/2026

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer