« Back
Home /
Recombinant Human Interferon-alpha 2b

Recombinant Human Interferon-alpha 2b

Item no.	cyt-205-20ug
Manufacturer	ProSpec
Amount	20ug
Category	Peptides & Proteins Recombinant Proteins
Type	Cytokines and Growth Factors
Specific against	Human (Homo sapiens)
ECLASS 10.1	42030690
ECLASS 11.0	42030690
UNSPSC	12352202
Similar products	IFN a 2b
Available
Synonyms	Interferon alpha 2b, IFNA, INFA2, MGC125764, MGC125765
Introduction	IFN-alpha is produced by macrophages and has antiviral activities. Interferon stimulates the production of two enzymes: protein kinase and an oligoadenylate synthetase.
Description	Interferon-a 2b Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 166 amino acids and having a molecular mass of 19400 Dalton. The Interferon-alpha 2b gene was obtained from human leukocytes. The IFN-a 2b is purified by proprietary chromatographic techniques.
Source	Escherichia Coli.
Physical Appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation	Lyophilized from a (1 mg/ml) solution in containing 2.3 mg Sodium phosphate dibasic and 0.55 mg sodium phosphate monobasic buffer.
Purity	Greater than 98.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Usage	ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Amino acid sequence	MCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLF STMDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSP CAWEVVRAEIMRSFSLSTNLQESLRSKE.
Biological Activity	The specific activity as determined in a viral resistance assay using bovine kidney MDBK cells was found to be 260, 000, 000 IU/ mg.
Storage	Lyophilized Interferon although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution IFN alpha 2b should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

cyt-205-20ug-safety-datasheet.pdf