« Back
Home /
Recombinant Human Interleukin-1 alpha

Recombinant Human Interleukin-1 alpha

Item no.	cyt-253-2ug
Manufacturer	ProSpec
Amount	2ug
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Type	Cytokines and Growth Factors
Specific against	Human (Homo sapiens)
ECLASS 10.1	42030690
ECLASS 11.0	42030690
UNSPSC	12352202
Similar products	IL 1 alpha
Available
Synonyms	Hematopoietin-1, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL-1 alpha, IL1, IL-1A, IL1F1
Introduction	IL-1 alpha is produced by activated macrophages, stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1A proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Description	Interleukin-1 alpha Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 159 amino acids and having a molecular mass of 18022 Dalton. The IL-1A is purified by proprietary chromatographic techniques.
Source	Escherichia Coli.
Physical Appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation	The protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 25mM Tris-HCl, pH 8.
Purity	Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Usage	ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Amino acid sequence	SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE NQA.
Biological Activity	The ED₅₀ as determined by the dose-dependant stimulation of murine D10S cells is 0.001 ng/ml, corresponding to a Specific Activity of 1 x 10⁹ IU/mg.
Storage	Lyophilized Interleukin-1 alpha although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution IL-1a should be stored at 4C between 2-7 days and for future use below -18C. Please prevent freeze-thaw cycles.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

cyt-253-2ug-safety-datasheet.pdf