« Back
Home /
Recombinant Human Macrophage Migration Inhibitor Factor, His Tag C-Terminus

Recombinant Human Macrophage Migration Inhibitor Factor, His Tag C-Terminus

Item no.	cyt-521-5ug
Manufacturer	ProSpec
Amount	5ug
Category	Peptides & Proteins Recombinant Proteins
Type	Cytokines and Growth Factors
Specific against	Human (Homo sapiens)
Conjugate/Tag	His
ECLASS 10.1	42030690
ECLASS 11.0	42030690
UNSPSC	12352202
Similar products	MIF His C
Available
Synonyms	Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF
Introduction	The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.
Description	MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques. Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chaincontaining 123 amino acidsand having a molecular mass of 13.5 kDa.
Source	Escherichia Coli.
Physical Appearance	Sterile Filtered lyophilized powder.
Formulation	Human MIF was lyophilized from a 1mg/ml solution containing PBS pH-7.4.
Purity	Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Usage	ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Amino acid sequence	MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPC ALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTF ALEHHHHHH.
Biological Activity	Measured by its ability to bind rhCD74 in a functional ELISA.
Storage	Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution MIF should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

cyt-521-5ug-safety-datasheet.pdf