« Back
Home /
Recombinant Human Ubiquitin Conjugating Enzyme E2B

Recombinant Human Ubiquitin Conjugating Enzyme E2B

Item no.	enz-340-2ug
Manufacturer	ProSpec
Amount	2ug
Category	Peptides & Proteins Enzymes
Type	Enzymes
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160410
ECLASS 11.0	32160410
UNSPSC	12352204
Similar products	UBE2B
Available
Synonyms	Ubiquitin-conjugating enzyme E2 B, EC 6 3 2 19, Ubiquitin-protein ligase B, Ubiquitin carrier protein B, HR6B, hHR6B, E2-17 kDa UBC2, HHR6B, RAD6B, E2-17kDa, UBE2B
Introduction	This E2 enzyme encodes for the human homolog of the yeast DNA repair gene RAD6, which is induced by DNA damaging agents. UBE2B can conjugate ubiquitin to histone H2A in an E3- independent manner in vitro, and is essential for the multi-ubiquitination and degradation of N-end rule substrates. Additionally, UBE2B may have a role in sepsis-induced muscle protein proteolysis and cancer-induced cachexia.
Description	Ubiquitin Conjugating Enzyme E2B Human Recombinant produced in E.coli is a 19 kDa protein containing 166 amino acids. The UE2B protein contains 6xHis tag and is purified by proprietary chromatographic techniques.
Source	Escherichia Coli.
Physical Appearance	Sterile Filtered white lyophilized powder.
Formulation	Lyophilized from a 0.2m filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5.
Purity	Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Usage	ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Amino acid sequence	MHHHHHHAMGQLRSMSTPARRRLMRDFKRLQEDPPVGVSGAPSENN IMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVY ADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQE NKREYEKRVSAIVEQSWNDS.
Storage	Lyophilized UBE2B although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution UBE2B should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

enz-340-2ug-safety-datasheet.pdf