« Back
Home /
Recombinant Hepatitis B Surface Antigen preS2

Recombinant Hepatitis B Surface Antigen preS2

Item no.	hbs-874-10ug
Manufacturer	ProSpec
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Viral Antigens
Specific against	other
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352202
Similar products	HBsAg preS2
Available
Introduction	Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanning S domain. In addition, MHBs has a 55 amino acid region called preS2.
Description	The Recombinant Hepatitis B Surface Antigen preS2 is a approximately 5.7 kDa, a single non-glycosylated polypeptide chain containing 55 amino acids. Purified by proprietary chromatographic technique.
Formulation	HBsAg protein was lyophilized from 0.2m filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl.
Purity	HBsAg protein is >95% pure as determined by 10% PAGE (coomassie staining).
Usage	ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Amino acid sequence	MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN.
Purification Method	HBsAg protein was purified by proprietary chromatographic technique.
Storage	This lyophilized preparation is stable at 2-8C, but should be kept at -20C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20C to -70C. Avoid repeated freeze/thaw cycles.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

hbs-874-10ug-safety-datasheet.pdf