« Back
Home /
Protein G

Protein G

Item no.	ANTI-A60967-100
Manufacturer	Antibodies.com
Amount	100mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	lyophilized powder
Specific against	other
Purity	>96% as determined by SDS-PAGE and RP-HPLC.
Sequence	LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Product Description	Protein G Recombinant
Product form	Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation	Lyophilized white powder containing no additives.
Storage	Lyophilized Recombinant Protein G although stable at room temperature for 3 weeks, should be stored desiccated below -18° C. Upon reconstitution Protein G should be stored at 4° C between 2-7 days and for future use below -18° C.Please prevent freeze-thaw cycles.
Target	Protein G

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100mg

available

Delivery expected until 10/2/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer