« Back
Home /
CNTF Rat

CNTF Rat

Item no.	ANTI-A63604-25
Manufacturer	Antibodies.com
Amount	25ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	lyophilized powder
Specific against	other
Purity	>99.0% as determined by:(a) Analysis by Gel Filtration.(b) Analysis by SDS-PAGE.
Sequence	AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Product Description	Ciliary Neurotrophic Factor Rat Recombinant
Product form	Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation	Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3.
Storage	Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CNTF should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer