Comparison

Recombinant Human C-C chemokine receptor type 6 (CCR6)

Item no. BM-RPC20712-100ug
Manufacturer Biomatik
Amount 100 UG
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Sequence MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLL CSLQEVRQFSRLFVPIAYSLICVFGLLGNILVVIT FAFYKKARSMTDVYLLNMAIADILFVLTLPFWAVS HATGAWVFSNATCKLLKGIYAINFNCGMLLLTCIS MDRYIAIVQATKSFRLRSRTLPRSKIICLVVWGLS VIISSSTFVFNQKYNTQGSDVCEPKYQTVSEPIRW KLLMLGLELLFGFFIPLMFMIFCYTFIVKTLVQAQ NSK
Protein Family G-protein coupled receptor 1 family
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Chemokine receptor-like 3
Similar products Chemokine receptor-like 3
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Shipping Temperature
Ice packs
Storage Conditions
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)
58.5 kDa
Expression Region
1-374aa
Restrictions
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration
1 year
Endotoxin
Not Tested
Relevance
Receptor for the C-C type chemokine CCL20. Binds to CCL20 and subsequently transduces a signal by increasing the intracellular calcium ion levels Although CCL20 is its major ligand it can also act as a receptor for non-chemokine ligands such as beta-defensins. Binds to defensin DEFB1 leading to increase in intracellular calcium ions and cAMP levels. Its binding to DEFB1 is essential for the function of DEFB1 in regulating sperm motility and bactericidal activity. Binds to defensins DEFB4 and DEFB4A/B and mediates their chemotactic effects. The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/ memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and various autoimmune diseases. CCR6-mediated signals are essential for immune responses to microbes in the intestinal mucosa and in the modulation of inflammatory responses initiated by tissue insult and trauma. CCR6 is essential for the recruitment of both the proinflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation. Required for the normal migration of Th17 cells in Peyers-patches and other related tissue sites of the intestine and plays a role in regulating effector T-cell balance and distribution in inflamed intestine. Plays an important role in the coordination of early thymocyte precursor migration events important for normal subsequent thymocyte precursor development, but is not required for the formation of normal thymic natural regulatory T-cells (nTregs). Required for optimal differentiation of DN2 and DN3 thymocyte precursors. Essential for B-cell localization in the subepithelial dome of Peyers-patches and for efficient B-cell isotype switching to IgA in the Peyers-patches. Essential for appropriate anatomical distribution of memory B-cells in the spleen and for the secondary recall response of memory B-cells. Positively regulates sperm motility and chemotaxis via its binding to CCL20
Subcellular location
Cell membrane, Multi-pass membrane protein, Cell surface
Function
Receptor for the C-C type chemokine CCL20
Activity
Not Tested
Tissue Specificity
Sperm. Mainly localized in the tail and in the postacrosomal region but is also found in the midpiece and basal region in a small percentage of sperm cells. Reduced levels found in the sperms of asthenozoospermia and leukocytospermia patients (at protein level). Spleen, lymph nodes, appendix, and fetal liver. Expressed in lymphocytes, T-cells and B-cells but not in natural killer cells, monocytes or granulocytes.
Storage Buffer
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Pathway
Chemokinesignalingpathway
Manufacturer - Gene Name
CCR6
Sequence Information
Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 UG
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close