Recombinant Human BPI fold-containing family A member 1 (BPIFA1)

Lung-specific protein X Nasopharyngeal carcinoma-related protein Palate lung and nasal epithelium clone protein Secretory protein in upper respiratory tracts Short PLUNC1 Short name: SPLUNC1 Tracheal epithelium-enriched protein Von Ebner protein Hl

in vitro E.coli expression system

QFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNA LSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLG GLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSP DGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDI TAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDG LGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNE VLRGLDITLVHDIVNMLIHGLQFVIKV

N-terminal 6xHis-SUMO-tagged

>90% as determined by SDS-PAGE.

Not tested

Ice packs

1 year

Plays a role in the innate immune responses of the upper airways. Reduces the surface tension in secretions from airway epithelia and inhibits the formation of biofilm by pathogenic Gram-negative bacteria, such as P.aeruginosa and K.pneumoniae. Binds bacterial lipopolysaccharide (LPS). Negatively regulates proteolytic cleavage of SCNN1G, an event that is required for activation of the epithelial sodium channel (ENaC), and thereby contributes to airway surface liquid homeostasis and proper clearance of mucus. Plays a role in the airway inflammatory response after exposure to irritants. May attract macrophages and neutrophils. May be associated with tumor progression.

Secreted

Lung, upper airways and nasopharyngeal regions, including trachea and nasal epithelium. Specifically expressed in the secretory ducts and submucosal glands of tracheobronchial tissues. Highest expression in the trachea and progressive decrease from proximal (bronchial) to distal (bronchiolar) airways. Also expressed in lung cancers and some other types of cancer.