« Back
Home /
Recombinant Saxiphilin, partial for Lithobates catesbeiana, partial

Recombinant Saxiphilin, partial for Lithobates catesbeiana, partial

Item no.	BM-RPC23868-50ug
Manufacturer	Biomatik
Amount	50 UG
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Sequence	AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIAC TEASCPKGCVKQILKGEADAVKLEVQYMYEALMCG LLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVAL VKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSL IRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGD PKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVA FVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDG SRA
Protein Family	Transferrin family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	SAX
Similar products	SAX
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	43.7 kDa
Expression Region	484-844aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe3+. It may participate in a detoxification mechanism for neutralizing a microbial toxin.
Subcellular location	Secreted
Function	Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe(3+). It may participate in a detoxification mechanism for neutralizing a microbial toxin.
Activity	Not Tested
Tissue Specificity	Plasma. Highest levels of transcripts found in the liver, the lung, the pancreas and the brain.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	N/A
Sequence Information	Partial

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 UG

available

Delivery expected until 9/4/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer