« Back
Home /
Recombinant Human ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 (CD38), partial

Recombinant Human ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 (CD38), partial

Item no.	BM-RPC25754-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Oncology Metabolism Diabetes Glucose Homeostasis By Cell Type Hematology Leukemia Lymphoma Myeloma Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	2'-phospho-ADP-ribosyl cyclase (2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase (EC:2.4.99.20)) (2'-phospho-cyclic-ADP-ribose transferase) (ADP-ribosyl cyclase 1) (ADPRC 1) (Cyclic ADP-ribose hydrolase 1) (cADPr hydrolase 1) (T10)
Similar products	2'-phospho-ADP-ribosyl cyclase (2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase (EC:2.4.99.20)) (2'-phospho-cyclic-ADP-ribose transferase) (ADP-ribosyl cyclase 1) (ADPRC 1) (Cyclic ADP-ribose hydrolase 1) (cADPr hydrolase 1) (T10)
Available
Gene Name	CD38
Alternative Names	2'-phospho-ADP-ribosyl cyclase (2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase (EC:2.4.99.20)) (2'-phospho-cyclic-ADP-ribose transferase) (ADP-ribosyl cyclase 1) (ADPRC 1) (Cyclic ADP-ribose hydrolase 1) (cADPr hydrolase 1) (T10) (CD_antigen: CD38)
Uniprot	P28907
Source	Yeast
Expression Region	43-300aa
AA Sequence	VPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEM RHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKL GTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLED TLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSN NPVSVFWKTVSRRFAEAACDVVHVMLNGSRSKIFD KNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRD LCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQC VKNPEDSSCTSEI
Sequence Info	Partial
Tag Info	C-terminal 6xHis-tagged
Theoretical MW	30.7 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Synthesizes the second messagers cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate, the former a second messenger for glucose-induced insulin secretion. Also has cADPr hydrolase activity. Also moonlights as a receptor in cells of the immune system.
Function	Synthesizes the second messagers cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate, the former a second messenger for glucose-induced insulin secretion. Also has cADPr hydrolase activity. Also moonlights as a receptor in cells of the immune system.
Subcellular location	Membrane, Single-pass type II membrane protein
Protein Families	ADP-ribosyl cyclase family
Tissue Specificity	Expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma.
Paythway	Calciumsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 8/21/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer