« Back
Home /
Recombinant Rat Mast cell protease 1 (Mcpt1)

Recombinant Rat Mast cell protease 1 (Mcpt1)

Item no.	BM-RPC25817-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Rat (Rattus norvegicus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Chymase (Chymotrypsin-like protease) (CLIP protein) (Mast cell protease I) (rMCP-I) (rMCP-1)
Similar products	Chymase (Chymotrypsin-like protease) (CLIP protein) (Mast cell protease I) (rMCP-I) (rMCP-1)
Available
Gene Name	Mcpt1
Alternative Names	Chymase (Chymotrypsin-like protease) (CLIP protein) (Mast cell protease I) (rMCP-I) (rMCP-1)
Uniprot	P09650
Source	E.coli
Expression Region	21-260aa
AA Sequence	IIGGVESRPHSRPYMAHLEITTERGYKATCGGFLV TRQFVMTAAHCKGRETTVTLGVHDVSKTESTQQKI KVEKQIVHPNYNFYSNLHDIMLLKLQKKAKVTPAV DVIPLPQPSDFLKPGKMCRAAGWGQTGVTKPTSNT LREVKQRIMDKEACKNYFHYNYNFQVCVGSPRKIR SAYKGDSGGPLVCAGVAHGIVSYGRGDAKPPAVFT RISPYVPWINKVIKGKDLTSLSLHESESPS
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal Myc-tagged
Theoretical MW	28.6 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion. May participate in generating perivascular beta-protein which ultimately aggregates into amyloid-beta deposits.
Function	Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion. May participate in generating perivascular beta-protein which ultimately aggregates into amyloid-beta deposits.
Subcellular location	Secreted, Cytoplasmic granule
Protein Families	Peptidase S1 family, Granzyme subfamily

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer