« Back
Home /
Recombinant Human Transgelin-2 (TAGLN2)

Recombinant Human Transgelin-2 (TAGLN2)

Item no.	BM-RPC25832-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Epididymis tissue protein Li 7e,SM22-alpha homolog
Similar products	Epididymis tissue protein Li 7e, SM22-alpha homolog
Available
Gene Name	TAGLN2
Alternative Names	Epididymis tissue protein Li 7e, SM22-alpha homolog
Uniprot	P37802
Source	E.coli
Expression Region	2-199aa
AA Sequence	ANRGPAYGLSREVQQKIEKQYDADLEQILIQWITT QCRKDVGRPQPGRENFQNWLKDGTVLCELINALYP EGQAPVKKIQASTMAFKQMEQISQFLQAAERYGIN TTDIFQTVDLWEGKNMACVQRTLMNLGGLAVARDD GLFSGDPNWFPKKSKENPRNFSDNQLQEGKNVIGL QMGTNRGASQAGMTGYGMPRQIL
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 6xHis-SUMO-tagged
Theoretical MW	38.3 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Protein Families	Calponin family
Tissue Specificity	Expressed in epididymis (at protein level).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 9/4/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer