« Back
Home /
Recombinant Human L-lactate dehydrogenase A chain (LDHA), partial

Recombinant Human L-lactate dehydrogenase A chain (LDHA), partial

Item no.	BM-RPC25837-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Oncology By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Proliferation Toxicity & Cytotoxicity
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cell proliferation-inducing gene 19 protein,LDH muscle subunit,LDH-MRenal carcinoma antigen NY-REN-59
Similar products	Cell proliferation-inducing gene 19 protein, LDH muscle subunit, LDH-MRenal carcinoma antigen NY-REN-59
Available
Gene Name	LDHA
Alternative Names	Cell proliferation-inducing gene 19 protein, LDH muscle subunit, LDH-MRenal carcinoma antigen NY-REN-59
Uniprot	P00338
Source	E.coli
Expression Region	5-323aa
AA Sequence	KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISI LMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRT PKIVSGKDYNVTANSKLVIITAGARQQEGESRLNL VQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILT YVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLG VHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTL HPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTS WAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIK DDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKS ADTL
Sequence Info	Partial
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	39.1 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Involvement in disease	Glycogen storage disease 11 (GSD11)
Subcellular location	Cytoplasm
Protein Families	LDH/MDH superfamily, LDH family
Paythway	HIF-1signalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 10/2/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer