« Back
Home /
Recombinant Human Annexin A2 (ANXA2)

Recombinant Human Annexin A2 (ANXA2)

Item no.	BM-RPC25841-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Oncology Neuroscience Neuroinflammation By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Annexin IIAnnexin-2,Calpactin I heavy chain,Calpactin-1 heavy chain,Chromobindin-8Lipocortin IIPlacental anticoagulant protein IV,PAP-IVProtein Ip36
Similar products	Calpactin I heavy chain, Calpactin-1 heavy chain, Annexin IIAnnexin-2, Chromobindin-8Lipocortin IIPlacental anticoagulant protein IV, PAP-IVProtein Ip36
Available
Gene Name	ANXA2
Alternative Names	Annexin IIAnnexin-2, Calpactin I heavy chain, Calpactin-1 heavy chain, Chromobindin-8Lipocortin IIPlacental anticoagulant protein IV, PAP-IVProtein Ip36
Uniprot	P07355
Source	E.coli
Expression Region	2-339aa
AA Sequence	STVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAE RDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDI AFAYQRRTKKELASALKSALSGHLETVILGLLKTP AQYDASELKASMKGLGTDEDSLIEIICSRTNQELQ EINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAK GRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVP KWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRK EVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGK GTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLY YYIQQDTKGDYQKALLYLCGGDD
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal GST-tagged
Theoretical MW	65.6 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Calcium-regulated mbrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response.
Function	Calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response. Inhibits PCSK9-enhanced LDLR degradation, probably reduces PCSK9 protein levels via a translational mechanism but also competes with LDLR for binding with PCSK9
Subcellular location	Secreted, extracellular space, extracellular matrix, basement membrane, Melanosome
Protein Families	Annexin family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 8/21/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer