« Back
Home /
Recombinant Mouse Complement receptor type 2 (Cr2), partial

Recombinant Mouse Complement receptor type 2 (Cr2), partial

Item no.	BM-RPC25890-50ug
Manufacturer	Biomatik
Amount	50ug
Category	Neuroscience Neuroinflammation Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Complement C3d receptor CD_antigen: CD21
Similar products	Complement C3d receptor CD_antigen: CD21
Available
Gene Name	Cr2
Alternative Names	Complement C3d receptor CD_antigen: CD21
Uniprot	P19070
Source	E.coli
Expression Region	12-140aa
AA Sequence	ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSY RLIGEKAIFCISENQVHATWDKAPPICESVNKTIS CSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTM KGSKTVWCQANEMWGPTALPVCES
Sequence Info	Partial
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	18.1 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Receptor for complement C3d. Participates in B lymphocytes activation.
Function	Receptor for complement C3d and for HNRNPU. Participates in B lymphocytes activation.
Subcellular location	Membrane, Single-pass type I membrane protein
Protein Families	Receptors of complement activation (RCA) family
Tissue Specificity	B-lymphocytes.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer