« Back
Home /
Recombinant Human Krueppel-like factor 1 (KLF1)

Recombinant Human Krueppel-like factor 1 (KLF1)

Item no.	BM-RPC26036-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Erythroid krueppel-like transcription factor (EKLF) (EKLF)
Similar products	Erythroid krueppel-like transcription factor (EKLF) (EKLF)
Available
Gene Name	KLF1
Alternative Names	Erythroid krueppel-like transcription factor (EKLF) (EKLF)
Uniprot	Q13351
Source	E.coli
Expression Region	1-362aa
AA Sequence	MATAETALPSISTLTALGPFPDTQDDFLKWWRSEE AQDMGPGPPDPTEPPLHVKSEDQPGEEEDDERGAD ATWDLDLLLTNFSGPEPGGAPQTCALAPSEASGAQ YPPPPETLGAYAGGPGLVAGLLGSEDHSGWVRPAL RARAPDAFVGPALAPAPAPEPKALALQPVYPGPGA GSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAP QYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVG TGLGGTAEDPGVIAETAPSKRGRRSWARKRQAAHT CAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWEG CGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSR SDHLALHMKRHL
Sequence Info	Full Length
Tag Info	N-terminal 6xHis-B2M-tagged
Theoretical MW	52.2 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Transcription regulator of erythrocyte development that probably serves as a general switch factor during erythropoiesis. Is a dual regulator of fetal-to-adult globin switching. Binds to the CACCC box in the beta-globin gene promoter and acts as a preferential activator of this gene. Furthermore, it binds to the BCL11A promoter and activates expression of BCL11A, which in turn represses the HBG1 and HBG2 genes. This dual activity ensures that, in most adults, fetal hemoglobin levels are low. Able to activate CD44 and AQP1 promoters. When sumoylated, acts as a transcriptional repressor by promoting interaction with CDH2/MI2beta and also represses megakaryocytic differentiation.
Function	Transcription regulator of erythrocyte development that probably serves as a general switch factor during erythropoiesis. Is a dual regulator of fetal-to-adult globin switching. Binds to the CACCC box in the beta-globin gene promoter and acts as a preferential activator of this gene. Furthermore, it binds to the BCL11A promoter and activates expression of BCL11A, which in turn represses the HBG1 and HBG2 genes. This dual activity ensures that, in most adults, fetal hemoglobin levels are low. Able to activate CD44 and AQP1 promoters. When sumoylated, acts as a transcriptional repressor by promoting interaction with CDH2/MI2beta and also represses megakaryocytic differentiation.
Involvement in disease	Anemia, congenital dyserythropoietic, 4 (CDAN4)
Subcellular location	Nucleus
Protein Families	Krueppel C2H2-type zinc-finger protein family
Tissue Specificity	Expression restricted to adult bone marrow and fetal liver. Not expressed in myeloid nor lymphoid cell lines.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 8/28/2025

Compare

Add to wishlist

Get an offer

Request delivery time