« Back
Home /
Recombinant Mouse Homeobox protein OTX2 (Otx2)

Recombinant Mouse Homeobox protein OTX2 (Otx2)

Manufacturer	Biomatik
Category	Oncology Neuroscience Neural Lineage Markers By Cell Type Blastoma Peptides & Proteins Recombinant Proteins S100 Calcium Binding Protein B Markers
Type	Proteins Recombinant
Specific against	Mouse
Amount	100ug
Item no.	BM-RPC26174-100ug
Targets	OTX2
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene Name	Otx2
Alternative Names	Orthodenticle homolog 2 (Otx-2)
Uniprot	P80206
Source	E.coli
Expression Region	1-289aa
AA Sequence	MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATP RKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREE VALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQ NKVRPAKKKSSPAREVSSESGTSGQFTPPSSTSVP TIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSY PMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHH QLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGA SSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQ TSSWKFQVL
Sequence Info	Full Length
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	37.6 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Transcription factor probably involved in the development of the brain and the sense organs. Can bind to the bicoid/BCD target sequence: 5'-TCTAATCCC-3'.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 6/27/2024